PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_52.101
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family bZIP
Protein Properties Length: 458aa    MW: 49199.7 Da    PI: 5.8822
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_52.101genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.59.4e-16230285358
                                   XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                                   ++kr+rr+ +NRe+ArrsR+RK++ i eLe+ v +L  e ++L k+l+ ++ ++++
  evm.model.supercontig_52.101 230 DVKRARRMLSNRESARRSRRRKQEHINELETQVGQLRVEHSSLLKRLSDMNHKYDE 285
                                   78******************************************999988887776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.2E-19228292IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.243230285IPR004827Basic-leucine zipper domain
PfamPF001701.2E-13231284IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.41E-11231283No hitNo description
Gene3DG3DSA:1.20.5.1702.9E-12232283No hitNo description
PROSITE patternPS000360235250IPR004827Basic-leucine zipper domain
PfamPF124984.7E-23299419IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002240Biological Processresponse to molecule of oomycetes origin
GO:0009626Biological Processplant-type hypersensitive response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000693Biological Processpositive regulation of seed maturation
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MNTVFSVEDF SDSFWSAPDL AVAAAEIMNR SQSEWALERF FEEMSTSAPT NAIASSSLQS  60
QPSISTAERA HDNDVVEIGK PADHDNHNRS SPSGPSLTAR VDSEEYRAFL KNKLDLACAA  120
VALRASSVKP EDLGTQTENQ QKEAAKQPVP IQSGSQAQDY DTVPKDLTAV CSSVVQSEPG  180
ASPISAPALS ATQPKLVQAR QATSGSSRED SDEDEIEGDM GTTENTDPAD VKRARRMLSN  240
RESARRSRRR KQEHINELET QVGQLRVEHS SLLKRLSDMN HKYDEAAVDN RILKADIETL  300
RAKVKMAEET VKRVTGINPL FLAKSNIPSA AMPFVSNPMD TSLVGAVARQ PNPNQFLNQP  360
VPSIAAGTIP HQRLDNSFTG SALVAPGVNP QSDFRGNNIT ETAPFRLAAA AGPMQKQIGP  420
SASGVQKHVC PGVNPAEAMA GWNSGLPHAA TKNNQKC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1244251RRSRRRKQ
2246251SRRRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007050435.11e-150BZIP transcription factor family protein, putative isoform 1
SwissprotQ9M1G61e-71BZP25_ARATH; Basic leucine zipper 25
TrEMBLA0A061DQA61e-150A0A061DQA6_THECC; BZIP transcription factor family protein, putative isoform 1
STRINGPOPTR_0005s23900.11e-91(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58482645
Representative plantOGRP18391639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54620.11e-69basic leucine zipper 25